PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013619641.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MIKC_MADS
Protein Properties Length: 216aa    MW: 25052 Da    PI: 9.148
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013619641.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF79.62.2e-25958150
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                    krien  nr vtfskRrng+ KKA+E+ vLCda+va+i+f+s+gk+ +y+
  XP_013619641.1  9 KRIENANNRVVTFSKRRNGLVKKAKEITVLCDAKVALIVFASNGKMTDYC 58
                    79*********************************************997 PP

2K-box66.11.2e-2271173199
           K-box   1 yqkssgksleeakaeslqqelakLkkeienLq.....reqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqee 90 
                     yqk sgk+l++ak+e+l++e++ +kke+++Lq      e Rhl+Ged++sL+lk+L+ +e+++e++l k+R++++e+l+++ ++    ek+l ee
  XP_013619641.1  71 YQKLSGKKLWDAKHENLSNEIDMIKKENDSLQlelrkCEYRHLKGEDIQSLNLKNLMGIEHAIEHGLDKVRDHQMEFLMTKRRNV-SYEKMLVEE 164
                     899*****************************888776789**************************************998776.457777777 PP

           K-box  91 nkaLrkkle 99 
                     n++L+ +l+
  XP_013619641.1 165 NRQLSFQLQ 173
                     777765554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006630.333161IPR002100Transcription factor, MADS-box
SMARTSM004325.6E-38160IPR002100Transcription factor, MADS-box
CDDcd002651.37E-37280No hitNo description
SuperFamilySSF554551.44E-33296IPR002100Transcription factor, MADS-box
PRINTSPR004045.1E-26323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003195.6E-221057IPR002100Transcription factor, MADS-box
PRINTSPR004045.1E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004045.1E-263859IPR002100Transcription factor, MADS-box
PfamPF014861.7E-1382172IPR002487Transcription factor, K-box
PROSITE profilePS5129713.28784178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 216 aa     Download sequence    Send to blast
MGRGKIEIKR IENANNRVVT FSKRRNGLVK KAKEITVLCD AKVALIVFAS NGKMTDYCCP  60
SMDLGAMLDQ YQKLSGKKLW DAKHENLSNE IDMIKKENDS LQLELRKCEY RHLKGEDIQS  120
LNLKNLMGIE HAIEHGLDKV RDHQMEFLMT KRRNVSYEKM LVEENRQLSF QLQQQEMAIA  180
SNARGMMMRD QDGQFGYRVQ PTQPNLQEKI MSLVID
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_D2e-15263162MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C2e-15263162MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B2e-15263162MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A2e-15263162MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3p57_J2e-15289180Myocyte-specific enhancer factor 2A
3p57_I2e-15289180Myocyte-specific enhancer factor 2A
3p57_D2e-15289180Myocyte-specific enhancer factor 2A
3p57_C2e-15289180Myocyte-specific enhancer factor 2A
3p57_B2e-15289180Myocyte-specific enhancer factor 2A
3p57_A2e-15289180Myocyte-specific enhancer factor 2A
3kov_J2e-15289180Myocyte-specific enhancer factor 2A
3kov_I2e-15289180Myocyte-specific enhancer factor 2A
3kov_B2e-15289180Myocyte-specific enhancer factor 2A
3kov_A2e-15289180Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC9679610.0KC967961.1 Brassica oleracea var. viridis PI.a (PI.a) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013619641.11e-161PREDICTED: floral homeotic protein PISTILLATA-like isoform X1
SwissprotP480071e-141PIST_ARATH; Floral homeotic protein PISTILLATA
TrEMBLA0A0D3AK451e-149A0A0D3AK45_BRAOL; Uncharacterized protein
TrEMBLS5Y7Q41e-149S5Y7Q4_BRAOV; PI.a
STRINGBra020093.1-P1e-140(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53002751
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20240.11e-142MIKC_MADS family protein